2JM6: MCL-1

Solution structure of MCL-1 complexed with NOXAB. Determined by solution NMR. Released 20 Mar 2007.

Method: Solution NMR
Organism: Mus musculus
Chains: 2
Atoms: 1,506
Mol. weight: 21.41 kDa
Released: 20 Mar 2007

Explore 2JM6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JM6 contains 9 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	71-93	23

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	153-172	20
α-helix	185-215	31
α-helix	223-234	12
α-helix	242-261	20
α-helix	265-282	18
α-helix	284-289	6
α-helix	293-300	8
α-helix	303-304	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Noxa	A	protein	27	Mus musculus	Q9JM54 (AlphaFold model)
Myeloid cell leukemia-1 protein Mcl-1 homolog	B	protein	162	Mus musculus	P97287 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JM6_1 Noxa (chains A)
PADLKDECAQLRRIGDKVNLRQKLLNM

Sequence of entity 2 (B), FASTA

>2JM6_2 Myeloid cell leukemia-1 protein Mcl-1 homolog (chains B)
GPLGSEDDLYRQSLEIISRYLREQATGSKDSKPLGEAGAAGRRALETLRRVGDGVQRNHE
TAFQGMLRKLDIKNEGDVKSFSRVMVHVFKDGVTNWGRIVTLISFGAFVAKHLKSVNQES
FIEPLAETITDVLVRTKRDWLVKQRGWDGFVEFFHVQDLEGG

Primary citation

Structural insights into the degradation of Mcl-1 induced by BH3 domains. Czabotar, P.E., Lee, E.F., van Delft, M.F. et al. Proc Natl Acad Sci U S A (2007) 104:6217-6222. DOI 10.1073/pnas.0701297104 · PubMed

Other PDB entries of the same protein (UniProt Q9JM54 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2NLA 2.8 Å, Crystal structure of the Mcl-1:mNoxaB BH3 complex
2ROD Solution Structure of MCL-1 Complexed with NoxaA

Browse structure collections

About this viewer

MolViewer shows 2JM6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.