2JMO: IBR domain of Human Parkin

Name: PDB 2JMO: IBR domain of Human Parkin
Published: 2007-02-27
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

IBR domain of Human Parkin. Determined by solution NMR. Released 27 Feb 2007.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 598
Mol. weight: 8.75 kDa
Ligands: ZN
Released: 27 Feb 2007

Explore 2JMO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JMO contains 0 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	46	1	1
β-strand	60-61	2	1
β-strand	66-67	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Parkin	A	protein	80	Homo sapiens	O60260 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JMO_1 Parkin (chains A)
GHMGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAF
CRECKEAYHEGECSAVFEAS

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Structure of the Parkin in-between-ring domain provides insights for E3-ligase dysfunction in autosomal recessive Parkinson's disease. Beasley, S.A., Hristova, V.A., Shaw, G.S. Proc Natl Acad Sci U S A (2007) 104:3095-3100. DOI 10.1073/pnas.0610548104 · PubMed

Other PDB entries of the same protein (UniProt O60260 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4I1F 1.58 Å, Structure of Parkin-S223P E3 ligase
5C1Z 1.79 Å, Parkin (UblR0RBR)
6GLC 1.8 Å, Structure of phospho-Parkin bound to phospho-ubiquitin
8WZN 1.8 Å, ParkinK211N in complex with phospho NEDD8
8IKM 1.92 Å, Trans complex of phospho parkin
4I1H 2.0 Å, Structure of Parkin E3 ligase
4BM9 2.25 Å, Structure of the autoinhibited Parkin catalytic domain
8WZO 2.25 Å, Parkin in complex with phospho NEDD8
5C9V 2.35 Å, Structure of human Parkin G319A
8IKV 2.35 Å, pUbl depleted phospho-Parkin(K211N,R163D) in complex with pUb
5C23 2.37 Å, Parkin (S65DUblR0RBR)
5N38 2.6 Å, S65DParkin and pUB complex

Browse structure collections

About this viewer

MolViewer shows 2JMO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.