Solution structure and resonance assignment of the N-terminal EVH1 domain from the human Spred2 protein (Sprouty-related protein with EVH1 domain isoform 2). Determined by solution NMR. Released 15 May 2007.
Explore 2JP2 in 3D Show helices and sheets RCSB PDB PDBe
2JP2 contains 1 α-helix and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 14-25 | 12 | 1 |
| β-strand | 33-34 | 2 | 1 |
| β-strand | 41-46 | 6 | 1 |
| β-strand | 49 | 1 | 2 |
| β-strand | 57 | 1 | 2 |
| β-strand | 59-65 | 7 | 1 |
| β-strand | 71-77 | 7 | 1 |
| β-strand | 83-87 | 5 | 1 |
| β-strand | 90-94 | 5 | 1 |
| β-strand | 99-104 | 6 | 1 |
| α-helix | 107-125 | 19 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sprouty-related, EVH1 domain-containing protein 2 | A | protein | 126 | Homo sapiens | Q7Z698 (AlphaFold model) |
>2JP2_1 Sprouty-related, EVH1 domain-containing protein 2 (chains A) GSMTEETHPDDDSYIVRVKAVVMTRDDSSGGWFPQEGGGISRVGVCKVMHPEGNGRSGFL IHGERQKDKLVVLECYVRKDLVYTKANPTFHHWKVDNRKFGLTFQSPADARAFDRGVRKA IEDLIE
1H, 13C and 15N resonance assignment of the human Spred2 EVH1 domain. Zimmermann, J., Jarchau, T., Walter, U. et al. J Biomol NMR (2004) 29:435-436. DOI 10.1023/B:JNMR.0000032526.17586.8c · PubMed
Other PDB entries of the same protein (UniProt Q7Z698 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2JP2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.