2JSS: Chaperone Chz1

NMR structure of chaperone Chz1 complexed with histone H2A.Z-H2B. Determined by solution NMR. Released 20 May 2008.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 1,965
Mol. weight: 28.03 kDa
Released: 20 May 2008

Explore 2JSS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JSS contains 14 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	6-16	11
α-helix	24-50	27
α-helix	59-69	11
α-helix	73-92	20
α-helix	98-101	4
α-helix	108-117	10
α-helix	130-155	26
α-helix	162-170	9
α-helix	173-179	7

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	12-16	5
α-helix	23-26	4
α-helix	34-36	3
α-helix	53-56	4
α-helix	57-61	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chimera of Histone H2B.1 and Histone H2A.Z	A	protein	192	Saccharomyces cerevisiae	P02293 (AlphaFold model), Q12692 (AlphaFold model)
Uncharacterized protein YER030W	B	protein	62	Saccharomyces cerevisiae	P40019 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JSS_1 Chimera of Histone H2B.1 and Histone H2A.Z (chains A)
RKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKLAAYNKKSTISAR
EIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQAQSSSARAGLQFPVGRIKRYLKRHAT
GRTRVGSKAAIYLTAVLEYLTAEVLELAGNAAKDLKVKRITPRHLQLAIRGDDELDSLIR
ATIASGGVLPHI

Sequence of entity 2 (B), FASTA

>2JSS_2 Uncharacterized protein YER030W (chains B)
TVEDSESDMDDAKLDALMGNEGEEEEDDLAEIDTSNIITSGRRTRGKVIDYKKTAEELDK
KE

Primary citation

NMR structure of chaperone Chz1 complexed with histones H2A.Z-H2B. Zhou, Z., Feng, H., Hansen, D.F. et al. Nat Struct Mol Biol (2008) 15:868-869. DOI 10.1038/nsmb.1465 · PubMed

Other PDB entries of the same protein (UniProt P02293 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6AE8 1.65 Å, Structure insight into histone chaperone Chz1-mediated H2A.Z recognition and replacement
4M6B 1.78 Å, Crystal structure of yeast Swr1-Z domain in complex with H2A.Z-H2B dimer
4WNN 1.8 Å, SPT16-H2A-H2B FACT HISTONE Complex
7DLX 2.4 Å, crystal structure of H2AM4>Z-H2B
5BT1 2.62 Å, histone chaperone Hif1 playing with histone H2A-H2B dimer
9C9G 2.91 Å, S.c INO80 in complex with S.c 0/80 nucleosome
9C9S 3.09 Å, S.c INO80 in complex with S.c 0/40 nucleosome, Class 1
7K78 3.1 Å, antibody and nucleosome complex
9C9T 3.16 Å, S.c INO80 in complex with S.c 0/40 nucleosome, Class 2
7SSA 3.2 Å, Cryo-EM structure of pioneer factor Cbf1 bound to the nucleosome
9OB1 3.2 Å, S.c INO80 in complex with Yeast 0/80 nucleosome, Apo State
4KUD 3.2 Å, Crystal structure of N-terminal acetylated Sir3 BAH domain D205N mutant in complex with…

Browse structure collections

About this viewer

MolViewer shows 2JSS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.