The Solution Structure of Calponin Homology Domain from Smoothelin-like 1. Determined by solution NMR. Released 27 May 2008.
Explore 2JV9 in 3D Show helices and sheets RCSB PDB PDBe
2JV9 contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 5-17 | 13 | |
| α-helix | 30-32 | 3 | |
| α-helix | 36-43 | 8 | |
| α-helix | 52-54 | 3 | |
| α-helix | 60-75 | 16 | |
| α-helix | 83-89 | 7 | |
| α-helix | 94-111 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Smoothelin-like 1 | A | protein | 119 | Mus musculus | Q99LM3 (AlphaFold model) |
>2JV9_1 Smoothelin-like 1 (chains A) GPLGSKNMLLEWCRAMTRNYEHVDIQNFSSSWSSGMAFCALIHKFFPEAFDYAELDPAKR RHNFTLAFSTAEKLADCAQLLEVDDMVRLAVPDSKCVYTYIQELYRSLVQKGLVKTKKK
Solution Structure of the Calponin Homology (CH) Domain from the Smoothelin-like 1 Protein: A UNIQUE APOCALMODULIN-BINDING MODE AND THE POSSIBLE ROLE OF THE C-TERMINAL TYPE-2 CH-DOMAIN IN SMOOTH MUSCLE RELAXATION. Ishida, H., Borman, M.A., Ostrander, J. et al. J Biol Chem (2008) 283:20569-20578. DOI 10.1074/jbc.M800627200 · PubMed
Other PDB entries of the same protein (UniProt Q99LM3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2JV9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.