2JXO: Second PDZ domain of NHERF-1

Structure of the second PDZ domain of NHERF-1. Determined by solution NMR. Released 9 Dec 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 750
Mol. weight: 10.73 kDa
Released: 9 Dec 2008

Explore 2JXO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JXO contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	153-158	6	1
β-strand	166-169	4	1
β-strand	177-182	6	1
α-helix	187-191	5
α-helix	197	1
β-strand	198-202	5	1
β-strand	205-206	2	1
α-helix	212-220	9
β-strand	225-230	6	1
α-helix	233-238	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ezrin-radixin-moesin-binding phosphoprotein 50	A	protein	98	Homo sapiens	O14745 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JXO_1 Ezrin-radixin-moesin-binding phosphoprotein 50 (chains A)
GIDPFTMLRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEV
NGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFK

Primary citation

Autoinhibitory Interactions between the PDZ2 and C-terminal Domains in the Scaffolding Protein NHERF1. Cheng, H., Li, J., Fazlieva, R. et al. Structure (2009) 17:660-669. DOI 10.1016/j.str.2009.03.009 · PubMed

Other PDB entries of the same protein (UniProt O14745 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4N6X 1.05 Å, Crystal Structure of the Chemokine Receptor CXCR2 in Complex with the First PDZ Domain…
4MPA 1.1 Å, Crystal structure of NHERF1-CXCR2 signaling complex in P21 space group
4LMM 1.1 Å, Crystal structure of NHERF1 PDZ1 domain complexed with the CXCR2 C-terminal tail in P21…
4JL7 1.16 Å, Crystal Structure of the Chemokine Receptor CXCR2 in Complex with the First PDZ Domain…
9RXT 1.36 Å, Structure of the PDZ1 domain from human NHERF1 with the C-terminal residues (NATRL) of…
9RXQ 1.38 Å, Structure of the PDZ1 domain from human NHERF1 with the C-terminal residues (KSTQF) of…
4Q3H 1.44 Å, The crystal structure of NHERF1 PDZ2 CXCR2 complex revealed by the NHERF1 CXCR2 chimeric…
4PQW 1.47 Å, Crystal Structure of Phospholipase C beta 3 in Complex with PDZ1 of NHERF1
1G9O 1.5 Å, First PDZ domain of the human na+/h+ exchanger regulatory factor
2OZF 1.5 Å, The crystal structure of the 2nd PDZ domain of the human NHERF-1 (SLC9A3R1)
1I92 1.7 Å, Structural basis of the nherf PDZ1-cftr interaction
1GQ5 2.2 Å, Structural Determinants of the NHERF Interaction with beta2-AR and PDGFR

Browse structure collections

About this viewer

MolViewer shows 2JXO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.