2JYV: Human Granulin F

Human Granulin F. Determined by solution NMR. Released 22 Apr 2008.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 236
Mol. weight: 7.98 kDa
Released: 22 Apr 2008

Explore 2JYV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JYV contains 1 α-helix and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 4 β-strands

Element	Residues	Length	Sheet
β-strand	2	1	1
β-strand	11	1	1
β-strand	15-19	5	2
β-strand	25-29	5	2
α-helix	30-31	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Granulin-2	A	protein	72	Homo sapiens	P28799 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2JYV_1 Granulin-2 (chains A)
AMAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCIK
LAAALEHHHHHH

Primary citation

Structure dissection of human progranulin identifies well-folded granulin/epithelin modules with unique functional activities. Tolkatchev, D., Malik, S., Vinogradova, A. et al. Protein Sci (2008) 17:711-724. DOI 10.1110/ps.073295308 · PubMed

Other PDB entries of the same protein (UniProt P28799 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8T8R 2.87 Å, Sortilin-PGRN peptide complex
8T8S 2.99 Å, Sortilin-PGRN peptide complex
1G26 The solution structure of a well-folded peptide based on the 31-residue amino-terminal…
2JYE Human Granulin A
2JYT Human Granulin C, isomer 1
2JYU Human Granulin C, isomer 2
6NUG hGRNA4-28_3s

Browse structure collections

About this viewer

MolViewer shows 2JYV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.