2JZO: PTS system mannose-specific EIIAB component

Name: PDB 2JZO: Solution NMR structure of the non-productive complex between IIAMannose and IIBMannose of the mannose transporter of the E. coli phosphotransferase system
Published: 2008-02-19
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Solution NMR structure of the non-productive complex between IIAMannose and IIBMannose of the mannose transporter of the E. coli phosphotransferase system. Determined by solution NMR. Released 19 Feb 2008.

Method: Solution NMR
Organism: Escherichia coli
Chains: 3
Atoms: 3,259
Mol. weight: 47.23 kDa
Released: 19 Feb 2008

Explore 2JZO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2JZO contains 19 α-helices and 27 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	1
β-strand	11	1	2
α-helix	13-25	13
β-strand	31-34	4	1
β-strand	36	1	2
β-strand	38	1	3
β-strand	40	1	3
α-helix	42-53	12
β-strand	62-66	5	1
α-helix	72-81	10
β-strand	87-91	5	1
α-helix	95-105	11
α-helix	111-124	14
β-strand	127-128	2	4

Chain D: 9 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	163-170	8	7
α-helix	178-185	8
β-strand	190-194	5	7
α-helix	196-199	4
α-helix	202-210	9
β-strand	217-221	5	7
α-helix	223-230	8
α-helix	233-235	3
β-strand	239-244	6	7
α-helix	247-255	9
β-strand	262-267	6	7
β-strand	275-276	2	8
β-strand	282-283	2	8
α-helix	285-296	12
β-strand	300-303	4	7
α-helix	310-311	2
β-strand	312-313	2	7
α-helix	314-319	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PTS system mannose-specific EIIAB component	A, B	protein	133	Escherichia coli	P69797 (AlphaFold model)
PTS system mannose-specific EIIAB component	D	protein	165	Escherichia coli	P69797 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2JZO_1 PTS system mannose-specific EIIAB component (chains A, B)
TIAIVIGTHGWAAEQLLKTAEMLLGEQENVGWIDFVPGENAETLIEKYNAQLAKLDTTKG
VLFLVDTWGGSPFNAASRIVVDKEHYEVIAGVNIPMLVETLMARDDDPSFDELVALAVET
GREGVKALKAKPV

Sequence of entity 2 (D), FASTA

>2JZO_2 PTS system mannose-specific EIIAB component (chains D)
NDYMVIGLARIDDRLIHGQVATRWTKETNVSRIIVVSDEVAADTVRKTLLTQVAPPGVTA
HVVDVAKMIRVYNNPKYAGERVMLLFTNPTDVERLVEGGVKITSVNVGGMAFRQGKTQVN
NAVSVDEKDIEAFKKLNARGIELEVRKVSTDPKLKMMDLISKIDK

Primary citation

Solution NMR Structures of Productive and Non-productive Complexes between the A and B Domains of the Cytoplasmic Subunit of the Mannose Transporter of the Escherichia coli Phosphotransferase System. Hu, J., Hu, K., Williams, D.C. et al. J Biol Chem (2008) 283:11024-11037. DOI 10.1074/jbc.M800312200 · PubMed

Other PDB entries of the same protein (UniProt P69797 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1PDO 1.7 Å, Phosphoenolpyruvate-dependent phosphotransferase system
1VRC Complex of enzyme IIAmannose and the histidine-containing phosphocarrier protein HPr…
1VSQ Solution NMR structure of the productive complex between IIAMannose and IIBMannose of…
2JZH structure of IIB domain of the mannose transporter of E. coli
2JZN Solution NMR structure of the productive complex between IIAMannose and IIBMannose of…

Browse structure collections

About this viewer

MolViewer shows 2JZO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.