Characterisation of the structural features and interactions of sclerostin: molecular insight into a key regulator of Wnt-mediated bone formation. Determined by solution NMR. Released 17 Feb 2009.
Explore 2K8P in 3D Show helices and sheets RCSB PDB PDBe
2K8P contains 0 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 58-63 | 6 | 1 |
| β-strand | 71-72 | 2 | 2 |
| β-strand | 76-81 | 6 | 1 |
| β-strand | 111-112 | 2 | 3 |
| β-strand | 115-123 | 9 | 2 |
| β-strand | 126 | 1 | 4 |
| β-strand | 128 | 1 | 4 |
| β-strand | 131-138 | 8 | 2 |
| β-strand | 141-142 | 2 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Sclerostin | A | protein | 189 | Homo sapiens | Q9BQB4 (AlphaFold model) |
>2K8P_1 Sclerostin (chains A) GWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELH FTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRV QLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKA NQAELENAY
Characterization of the Structural Features and Interactions of Sclerostin: Molecular insight into a key regulator of Wnt-mediated bone formation. Veverka, V., Henry, A.J., Slocombe, P.M. et al. J Biol Chem (2009) 284:10890-10900. DOI 10.1074/jbc.M807994200 · PubMed
Other PDB entries of the same protein (UniProt Q9BQB4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2K8P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.