2KBE: Amino-terminal domain of Dbp5p

solution structure of amino-terminal domain of Dbp5p. Determined by solution NMR. Released 13 Oct 2009.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 1,768
Mol. weight: 25.23 kDa
Released: 13 Oct 2009

Explore 2KBE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KBE contains 11 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	83-85	3
α-helix	87-90	4
α-helix	94-97	4
α-helix	101-109	9
α-helix	118-125	8
β-strand	134-137	4	1
α-helix	143-155	13
β-strand	165-168	4	1
α-helix	172-185	14
β-strand	194-196	3	1
β-strand	211-214	4	1
α-helix	219-224	6
β-strand	235-239	5	1
α-helix	241-246	6
α-helix	250-260	11
β-strand	267-270	4	1
α-helix	276-285	10
β-strand	290-293	4	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ATP-dependent RNA helicase DBP5	A	protein	226	Saccharomyces cerevisiae	P20449 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KBE_1 ATP-dependent RNA helicase DBP5 (chains A)
YEVKVKLADIQADPNSPLYSAKSFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNP
PRNMIAQSQSGTGKTAAFSLTMLTRVNPEDASPQAICLAPSRELARQTLEVVQEMGKFTK
ITSQLIVPDSFEKNKQINAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGL
GDQCIRVKRFLPKDTQLVLFSATFADAVRQYAKKIVPNANTLELQT

Primary citation

Solution and crystal structures of mRNA exporter Dbp5p and its interaction with nucleotides. Fan, J.S., Cheng, Z., Zhang, J. et al. J Mol Biol (2009) 388:1-10. DOI 10.1016/j.jmb.2009.03.004 · PubMed

Other PDB entries of the same protein (UniProt P20449 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PEY 1.4 Å, S. cerevisiae Dbp5 bound to RNA and ADP BeF3
3PEW 1.5 Å, S. cerevisiae Dbp5 L327V bound to RNA and ADP BeF3
3GFP 1.8 Å, Structure of the C-terminal domain of the DEAD-box protein Dbp5
5ELX 1.81 Å, S. cerevisiae Dbp5 bound to RNA and mant-ADP BeF3
3PEV 2.5 Å, S. cerevisiae Dbp5 L327V C-terminal domain bound to Gle1 and IP6
3PEU 2.6 Å, S. cerevisiae Dbp5 L327V C-terminal domain bound to Gle1 H337R and IP6
3RRM 2.9 Å, S. cerevisiae dbp5 l327v bound to nup159, gle1 h337r, ip6 and adp
3RRN 4.0 Å, S. cerevisiae dbp5 l327v bound to gle1 h337r and ip6
2KBF solution structure of carboxyl-terminal domain of Dbp5p

Browse structure collections

About this viewer

MolViewer shows 2KBE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.