2KJD: Extended PDZ2 domain from NHERF1

Solution structure of extended PDZ2 domain from NHERF1 (150-270). Determined by solution NMR. Released 29 Dec 2009.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 987
Mol. weight: 14.1 kDa
Released: 29 Dec 2009

Explore 2KJD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KJD contains 5 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	11-16	6	1
β-strand	24-28	5	1
β-strand	35-40	6	1
α-helix	45-49	5
β-strand	56-60	5	1
β-strand	63-64	2	1
α-helix	70-78	9
β-strand	83-89	7	1
α-helix	91-100	10
α-helix	106-109	4
α-helix	114-115	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sodium/hydrogen exchange regulatory cofactor NHE-RF1	A	protein	128	Homo sapiens	O14745 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KJD_1 Sodium/hydrogen exchange regulatory cofactor NHE-RF1 (chains A)
GIDPFTMLRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEV
NGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKCRVIPSQEHLNGPLPVPFTNG
EIQKENSR

Primary citation

A dynamic intramolecular conformational switch autoregulates the scaffolding protein NHERF1. Bhattacharya, S., Dai, Z., Li, J. et al. To be published.

Other PDB entries of the same protein (UniProt O14745 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4N6X 1.05 Å, Crystal Structure of the Chemokine Receptor CXCR2 in Complex with the First PDZ Domain…
4MPA 1.1 Å, Crystal structure of NHERF1-CXCR2 signaling complex in P21 space group
4LMM 1.1 Å, Crystal structure of NHERF1 PDZ1 domain complexed with the CXCR2 C-terminal tail in P21…
4JL7 1.16 Å, Crystal Structure of the Chemokine Receptor CXCR2 in Complex with the First PDZ Domain…
9RXT 1.36 Å, Structure of the PDZ1 domain from human NHERF1 with the C-terminal residues (NATRL) of…
9RXQ 1.38 Å, Structure of the PDZ1 domain from human NHERF1 with the C-terminal residues (KSTQF) of…
4Q3H 1.44 Å, The crystal structure of NHERF1 PDZ2 CXCR2 complex revealed by the NHERF1 CXCR2 chimeric…
4PQW 1.47 Å, Crystal Structure of Phospholipase C beta 3 in Complex with PDZ1 of NHERF1
1G9O 1.5 Å, First PDZ domain of the human na+/h+ exchanger regulatory factor
2OZF 1.5 Å, The crystal structure of the 2nd PDZ domain of the human NHERF-1 (SLC9A3R1)
1I92 1.7 Å, Structural basis of the nherf PDZ1-cftr interaction
1GQ5 2.2 Å, Structural Determinants of the NHERF Interaction with beta2-AR and PDGFR

Browse structure collections

About this viewer

MolViewer shows 2KJD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.