High-resolution solution structure of the ASIC1a blocker PcTX1. Determined by solution NMR. Released 1 Sept 2010.
Explore 2KNI in 3D Show helices and sheets RCSB PDB PDBe
2KNI contains 3 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 5 | 1 | 1 |
| α-helix | 15-17 | 3 | |
| β-strand | 18 | 1 | 1 |
| α-helix | 19 | 1 | |
| β-strand | 22-25 | 4 | 2 |
| β-strand | 33-36 | 4 | 2 |
| α-helix | 37-39 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Psalmotoxin-1 | A | protein | 41 | Psalmopoeus cambridgei | P60514 (AlphaFold model) |
>2KNI_1 Psalmotoxin-1 (chains A) SEDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT
A dynamic pharmacophore drives the interaction between Psalmotoxin-1 and the putative drug target acid-sensing ion channel 1a. Saez, N.J., Mobli, M., Bieri, M. et al. Mol Pharmacol (2011) 80:796-808. DOI 10.1124/mol.111.072207 · PubMed
Other PDB entries of the same protein (UniProt P60514 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2KNI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.