Solution structure of MAST205-PDZ complexed with the C-terminus of a rabies virus G protein. Determined by solution NMR. Released 10 Nov 2010.
Explore 2KQF in 3D Show helices and sheets RCSB PDB PDBe
2KQF contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-11 | 5 | 1 |
| β-strand | 19-27 | 9 | 1 |
| β-strand | 34-43 | 10 | 1 |
| α-helix | 49-52 | 4 | |
| α-helix | 58 | 1 | |
| β-strand | 59-63 | 5 | 1 |
| β-strand | 67 | 1 | 1 |
| α-helix | 73-83 | 11 | |
| β-strand | 86-91 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Microtubule-associated serine/threonine-protein kinase 2 | A | protein | 96 | Homo sapiens | Q6P0Q8 (AlphaFold model) |
| C-terminal motif from Glycoprotein | B | protein | 13 | Q8JJY9 |
>2KQF_1 Microtubule-associated serine/threonine-protein kinase 2 (chains A) GGSMRPPIIIHRAGKKYGFTLRAIRVYMGDSDVYTVHHMVWHVEDGGPASEAGLRQGDLI THVNGEPVHGLVHTEVVELILKSGNKVAISTTPLEN
>2KQF_2 C-terminal motif from Glycoprotein (chains B) SWESHKSGGETRL
1H, 13C and 15N resonance assignments of the PDZ of Microtubule-associated serine/threonine kinase 205 (MAST205) in complex with the C-Terminal motif from the rabies virus glycoprotein. Terrien, E., Wolff, N., Cordier, F. et al. To be published.
Other PDB entries of the same protein (UniProt Q6P0Q8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2KQF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.