2KQZ: Rpn13 DEUBAD domain

Solution structure of the Rpn13 DEUBAD domain. Determined by solution NMR. Released 26 May 2010.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,137
Mol. weight: 16.28 kDa
Released: 26 May 2010

Explore 2KQZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KQZ contains 10 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	266-273	8
α-helix	285-291	7
α-helix	298-302	5
α-helix	304-313	10
α-helix	324-328	5
α-helix	334-349	16
α-helix	353-358	6
α-helix	363-371	9
α-helix	374-384	11
α-helix	404-406	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proteasomal ubiquitin receptor ADRM1	A	protein	155	Homo sapiens	Q16186 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KQZ_1 Proteasomal ubiquitin receptor ADRM1 (chains A)
STAASPTQPIQLSDLQSILATMNVPAGPAGGQQVDLASVLTPEIMAPILANADVQERLLP
YLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKG
DVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD

Primary citation

Structure of Proteasome Ubiquitin Receptor hRpn13 and Its Activation by the Scaffolding Protein hRpn2. Chen, X., Lee, B.H., Finley, D. et al. Mol Cell (2010) 38:404-415. DOI 10.1016/j.molcel.2010.04.019 · PubMed

Other PDB entries of the same protein (UniProt Q16186 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5V1Y 1.42 Å, Crystal structure of the ternary RPN13 PRU-RPN2 (940-953)-ubiquitin complex
6OI4 1.76 Å, RPN13 (19-132)-RPN2 (940-952) pY950-Ub complex
5IRS 1.8 Å, crystal structure of the proteasomal Rpn13 PRU-domain
8VWO 1.85 Å, Crystal structure of hRpn13 Pru bound with U-shaped peptide
4WLR 2.0 Å, Crystal Structure of mUCH37-hRPN13 CTD-hUb complex
5V1Z 2.0 Å, Crystal structure of the RPN13 PRU-RPN2 (932-953)-ubiquitin complex
8FTQ 2.1 Å, Crystal structure of hRpn13 Pru domain in complex with Ubiquitin and XL44
4UEL 2.3 Å, UCH-L5 in complex with ubiquitin-propargyl bound to the RPN13 DEUBAD domain
9E7K 2.41 Å, Crystal structure of the UCH37 RPN13 DEUBAD complex bound to an inhibitory nanobody in…
4UEM 2.82 Å, UCH-L5 in complex with the RPN13 DEUBAD domain
4WLQ 2.85 Å, Crystal structure of mUCH37-hRPN13 CTD complex
2KR0 Solution structure of the proteasome ubiquitin receptor Rpn13

Browse structure collections

About this viewer

MolViewer shows 2KQZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.