2KR9: Kalirin DH1 NMR structure

Kalirin DH1 NMR structure. Determined by solution NMR. Released 15 Dec 2010.

Method: Solution NMR
Organism: Rattus norvegicus
Chains: 1
Atoms: 1,545
Mol. weight: 22 kDa
Released: 15 Dec 2010

Explore 2KR9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KR9 contains 17 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 0 β-strands

Element	Residues	Length
α-helix	17-34	18
α-helix	35-39	5
α-helix	40-43	4
α-helix	57-60	4
α-helix	65-70	6
α-helix	71-75	5
α-helix	76-79	4
α-helix	80-82	3
α-helix	86-88	3
α-helix	90-95	6
α-helix	98-101	4
α-helix	102-108	7
α-helix	110-116	7
α-helix	117-121	5
α-helix	124-132	9
α-helix	138-162	25
α-helix	170-186	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kalirin	A	protein	190	Rattus norvegicus	P97924 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KR9_1 Kalirin (chains A)
GPLGSPEFPGRKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPPGILNKEHII
FGNIQEIYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSNQLILEH
AGTFFDEIQQRHGLANSISSYLIKPVQRVTKYQLLLKELLTCCEEGKGELKDGLEVMLSV
PKKANDAMHV

Primary citation

The solution NMR structure of the first Dbl domain of RhoGEF Kalirin. Gorbatyuk, V.Y., Schiller, M.R., Hoch, J.C. To be published.

Other PDB entries of the same protein (UniProt P97924 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9IFK 1.34 Å, Crystal structure of Kalirin/Rac1 in complex with DK-2
9HU8 1.48 Å, Crystal structure of Kalirin/Rac1 in complex with MC-278.
5O33 1.64 Å, A structure of the GEF Kalirin DH1 domain in complex with the small GTPase Rac1
9IG1 1.65 Å, Crystal structure of Kalirin/Rac1 in complex with DK-652
9I1L 1.68 Å, Crystal structure of Kalirin/Rac1 in complex with RS-009
1U3O Solution structure of rat Kalirin N-terminal SH3 domain

Browse structure collections

About this viewer

MolViewer shows 2KR9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.