2KRG: Na/H exchange regulatory cofactor NHE-RF1

Solution Structure of human sodium/ hydrogen exchange regulatory factor 1(150-358). Determined by solution NMR. Released 29 Dec 2009.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,657
Mol. weight: 23.67 kDa
Released: 29 Dec 2009

Explore 2KRG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KRG contains 9 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	153-158	6	1
β-strand	166-168	3	2
β-strand	178	1	3
β-strand	179-182	4	2
α-helix	187-191	5
β-strand	198	1	3
β-strand	201-202	2	1
β-strand	205-206	2	1
α-helix	213-222	10
β-strand	225-230	6	1
α-helix	233-242	10
α-helix	248-251	4
α-helix	269-271	3
α-helix	275-277	3
α-helix	297-299	3
α-helix	323-328	6
α-helix	331-333	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Na(+)/H(+) exchange regulatory cofactor NHE-RF1	A	protein	216	Homo sapiens	O14745 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KRG_1 Na(+)/H(+) exchange regulatory cofactor NHE-RF1 (chains A)
GIDPFTMLRPRLCTMKKGPSGYGFNLHSDKSKPGQFIRSVDPDSPAEASGLRAQDRIVEV
NGVCMEGKQHGDVVSAIRAGGDETKLLVVDRETDEFFKKCRVIPSQEHLNGPLPVPFTNG
EIQKENSREALAEAALESPRPALVRSASSDTSEELNSQDSPPKQDSTAPSSTSSSDPILD
FNISLAMAKERAHQKRSSKRAPQMDWSKKNELFSNL

Primary citation

A conformational switch in the scaffolding protein NHERF1 controls autoinhibition and complex formation. Bhattacharya, S., Dai, Z., Li, J. et al. J Biol Chem (2010) 285:9981-9994. DOI 10.1074/jbc.M109.074005 · PubMed

Other PDB entries of the same protein (UniProt O14745 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4N6X 1.05 Å, Crystal Structure of the Chemokine Receptor CXCR2 in Complex with the First PDZ Domain…
4MPA 1.1 Å, Crystal structure of NHERF1-CXCR2 signaling complex in P21 space group
4LMM 1.1 Å, Crystal structure of NHERF1 PDZ1 domain complexed with the CXCR2 C-terminal tail in P21…
4JL7 1.16 Å, Crystal Structure of the Chemokine Receptor CXCR2 in Complex with the First PDZ Domain…
9RXT 1.36 Å, Structure of the PDZ1 domain from human NHERF1 with the C-terminal residues (NATRL) of…
9RXQ 1.38 Å, Structure of the PDZ1 domain from human NHERF1 with the C-terminal residues (KSTQF) of…
4Q3H 1.44 Å, The crystal structure of NHERF1 PDZ2 CXCR2 complex revealed by the NHERF1 CXCR2 chimeric…
4PQW 1.47 Å, Crystal Structure of Phospholipase C beta 3 in Complex with PDZ1 of NHERF1
1G9O 1.5 Å, First PDZ domain of the human na+/h+ exchanger regulatory factor
2OZF 1.5 Å, The crystal structure of the 2nd PDZ domain of the human NHERF-1 (SLC9A3R1)
1I92 1.7 Å, Structural basis of the nherf PDZ1-cftr interaction
1GQ5 2.2 Å, Structural Determinants of the NHERF Interaction with beta2-AR and PDGFR

Browse structure collections

About this viewer

MolViewer shows 2KRG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.