Substance P in DMPC/CHAPS isotropic q=0.25 bicelles as a ligand for NK1R. Determined by solution NMR. Released 3 Nov 2010.
Explore 2KSA in 3D Show helices and sheets RCSB PDB PDBe
2KSA contains 13 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 29-59 | 31 | |
| α-helix | 66-80 | 15 | |
| α-helix | 81-85 | 5 | |
| α-helix | 86-95 | 10 | |
| α-helix | 102-135 | 34 | |
| α-helix | 144-162 | 19 | |
| β-strand | 173 | 1 | 1 |
| β-strand | 180 | 1 | 1 |
| α-helix | 193-199 | 7 | |
| α-helix | 200-206 | 7 | |
| α-helix | 207-221 | 15 | |
| α-helix | 238-273 | 36 | |
| α-helix | 284-308 | 25 | |
| α-helix | 310-320 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 369-372 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Substance-P receptor | A | protein | 364 | Homo sapiens | P25103 (AlphaFold model) |
| Substance P | B | protein | 11 | P20366 (AlphaFold model) |
>2KSA_1 Substance-P receptor (chains A) MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAH KRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASI YSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVC MIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV SAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMY NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTIST VVGA
>2KSA_2 Substance P (chains B) RPKPQQFFGLM
NMR evidence of GM1-induced conformational change of Substance P using isotropic bicelles. Gayen, A., Goswami, S.K., Mukhopadhyay, C. Biochim Biophys Acta (2010). DOI 10.1016/j.bbamem.2010.09.023 · PubMed
Other PDB entries of the same protein (UniProt P25103 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2KSA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.