2KSA: Substance-P receptor

Substance P in DMPC/CHAPS isotropic q=0.25 bicelles as a ligand for NK1R. Determined by solution NMR. Released 3 Nov 2010.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 3,023
Mol. weight: 43.03 kDa
Released: 3 Nov 2010

Explore 2KSA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KSA contains 13 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	29-59	31
α-helix	66-80	15
α-helix	81-85	5
α-helix	86-95	10
α-helix	102-135	34
α-helix	144-162	19
β-strand	173	1	1
β-strand	180	1	1
α-helix	193-199	7
α-helix	200-206	7
α-helix	207-221	15
α-helix	238-273	36
α-helix	284-308	25
α-helix	310-320	11

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	369-372	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Substance-P receptor	A	protein	364	Homo sapiens	P25103 (AlphaFold model)
Substance P	B	protein	11		P20366 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2KSA_1 Substance-P receptor (chains A)
MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAH
KRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASI
YSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVC
MIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMY
NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTIST
VVGA

Sequence of entity 2 (B), FASTA

>2KSA_2 Substance P (chains B)
RPKPQQFFGLM

Primary citation

NMR evidence of GM1-induced conformational change of Substance P using isotropic bicelles. Gayen, A., Goswami, S.K., Mukhopadhyay, C. Biochim Biophys Acta (2010). DOI 10.1016/j.bbamem.2010.09.023 · PubMed

Other PDB entries of the same protein (UniProt P25103 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HLP 2.2 Å, Crystal structure of the Neurokinin 1 receptor in complex with the small molecule…
6HLO 2.4 Å, Crystal structure of the Neurokinin 1 receptor in complex with the small molecule…
8U26 2.5 Å, Gaussian Mixture Models based single particle refinement - GPCR (Substance P bound to…
6J20 2.7 Å, Crystal structure of the human NK1 substance P receptor
7P00 2.71 Å, Human Neurokinin 1 receptor (NK1R) substance P Gq chimera (mGsqi) complex
7P02 2.87 Å, Human Neurokinin 1 receptor (NK1R) substance P Gs complex
7RMG 3.0 Å, Substance P bound to active human neurokinin 1 receptor in complex with miniGs/q70
7RMH 3.1 Å, Substance P bound to active human neurokinin 1 receptor in complex with miniGs399
6J21 3.2 Å, Crystal structure of the human NK1 substance P receptor
7RMI 3.2 Å, SP6-11 biased agonist bound to active human neurokinin 1 receptor in complex with…
6HLL 3.27 Å, Crystal structure of the Neurokinin 1 receptor in complex with the small molecule…
6E59 3.4 Å, Crystal structure of the human NK1 tachykinin receptor

Browse structure collections

About this viewer

MolViewer shows 2KSA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.