2KT5: RRM domain of mRNA export adaptor REF2-I

RRM domain of mRNA export adaptor REF2-I bound to HSV-1 ICP27 peptide. Determined by solution NMR. Released 12 Jan 2011.

Method: Solution NMR
Organisms: Mus musculus, Human herpesvirus 1
Chains: 2
Atoms: 1,251
Mol. weight: 17.87 kDa
Released: 12 Jan 2011

Explore 2KT5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KT5 contains 3 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	75-80	6	1
α-helix	88-96	9
β-strand	103-107	5	1
β-strand	117-122	6	1
α-helix	125-135	11
β-strand	138-139	2	2
β-strand	144-145	2	2
β-strand	146-150	5	1

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	128-131	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA and export factor-binding protein 2	A	protein	124	Mus musculus	Q9JJW6 (AlphaFold model)
ICP27	B	protein	40	Human herpesvirus 1	Q9J0X9

Sequence of entity 1 (A), FASTA

>2KT5_1 RNA and export factor-binding protein 2 (chains A)
MASMTGGQQMGRDPDKWQHDLFDSGCGGGEGVETGAKLLVSNLDFGVSDADIQELFAEFG
TLKKAAVDYDRSGRSLGTADVHFERRADALKAMKQYKGVPLDGRPMDIQLVASQIDLEHH
HHHH

Sequence of entity 2 (B), FASTA

>2KT5_2 ICP27 (chains B)
GPLGSVWSRLGARRPSCSPERHGGKVARLQPPPTKAQPAR

Primary citation

Structural Basis for the Recognition of Cellular mRNA Export Factor REF by Herpes Viral Proteins HSV-1 ICP27 and HVS ORF57. Tunnicliffe, R.B., Hautbergue, G.M., Kalra, P. et al. PLoS Pathog (2011) 7:e1001244-e1001244. DOI 10.1371/journal.ppat.1001244 · PubMed

Other PDB entries of the same protein (UniProt Q9JJW6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8SRR 3.22 Å, Cryo-EM structure of the CBC-ALYREF complex
2F3J The solution structure of the REF2-I mRNA export factor (residues 1-155).
2YKA RRM domain of mRNA export adaptor REF2-I bound to HVS ORF57 peptide

Browse structure collections

About this viewer

MolViewer shows 2KT5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.