Solution structure of the CBX7 chromodomain in complex with a H3K27me2 peptide. Determined by solution NMR. Released 30 Jun 2010.
Explore 2KVM in 3D Show helices and sheets RCSB PDB PDBe
2KVM contains 2 α-helices and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 13-22 | 10 | 1 |
| β-strand | 25-32 | 8 | 1 |
| α-helix | 37-39 | 3 | |
| β-strand | 41-44 | 4 | 1 |
| α-helix | 51-65 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Chromobox protein homolog 7 | A | protein | 74 | Mus musculus | Q8VDS3 (AlphaFold model) |
| histone H3 peptide (residues 15-30) with dimethylated lysine 27 | B | protein | 16 |
>2KVM_1 Chromobox protein homolog 7 (chains A) GSHMELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAY EEKEERDRASGYRK
>2KVM_2 histone H3 peptide (residues 15-30) with dimethylated lysine 27 (chains B) APRKQLATKAARKSAP
Molecular interplay of the noncoding RNA ANRIL and methylated histone H3 lysine 27 by polycomb CBX7 in transcriptional silencing of INK4a. Yap, K.L., Li, S., Munoz-Cabello, A.M. et al. Mol Cell (2010) 38:662-674. DOI 10.1016/j.molcel.2010.03.021 · PubMed
Other PDB entries of the same protein (UniProt Q8VDS3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2KVM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.