2KW3: DNA-binding protein RFX5

Heterotrimeric interaction between RFX5 and RFXAP. Determined by solution NMR. Released 25 Aug 2010.

Method: Solution NMR
Organism: Homo sapiens
Chains: 3
Atoms: 1,544
Mol. weight: 22.03 kDa
Released: 25 Aug 2010

Explore 2KW3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2KW3 contains 10 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	30-36	7
α-helix	40-54	15
α-helix	58-66	9
α-helix	74-78	5

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	30-35	6
α-helix	40-54	15
α-helix	59-66	8
α-helix	74-78	5

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	226-237	12
α-helix	242-258	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-binding protein RFX5	A, B	protein	68	Homo sapiens	P48382 (AlphaFold model)
Regulatory factor X-associated protein	C	protein	62	Homo sapiens	O00287 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2KW3_1 DNA-binding protein RFX5 (chains A, B)
GAGEPTTLLQRLRGTISKAVQNKVEGILQDVQKFSDNDKLYLYLQLPSGPTTGDKSSEPS
TLSNEEYM

Sequence of entity 2 (C), FASTA

>2KW3_2 Regulatory factor X-associated protein (chains C)
GHGTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGT
SM

Primary citation

Solution structure of the heterotrimeric complex between RFX5 and RFXAP reveals molecular details associated with MHCII gene expression. Laird, K.M., Briggs, L.L., Boss, J.M. et al. To be published.

Other PDB entries of the same protein (UniProt P48382 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3V30 1.57 Å, Crystal Structure of the Peptide Bound Complex of the Ankyrin Repeat Domains of Human…
8ZJR 3.3 Å, Structure of nucleosome-bound RFX5 complex

Browse structure collections

About this viewer

MolViewer shows 2KW3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.