Solution NMR Structure of Nonsense mRNA reducing factor 3A from H. Sapiens, Northeast Structural Genomics Consortium Target HR4714B. Determined by solution NMR. Released 11 Aug 2010.
Explore 2L08 in 3D Show helices and sheets RCSB PDB PDBe
2L08 contains 3 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-8 | 3 | |
| β-strand | 12-15 | 4 | 1 |
| α-helix | 23-26 | 4 | |
| β-strand | 36-38 | 3 | 1 |
| β-strand | 57-60 | 4 | 1 |
| α-helix | 63-72 | 10 | |
| β-strand | 76-79 | 4 | 2 |
| β-strand | 85-88 | 4 | 2 |
| β-strand | 89-92 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Regulator of nonsense transcripts 3A | A | protein | 97 | Homo sapiens | Q9H1J1 (AlphaFold model) |
>2L08_1 Regulator of nonsense transcripts 3A (chains A) MGHHHHHHSHMVVIRRLPPGLTKEQLEEQLRPLPAHDYFEFFAADLSLYPHLYSRAYINF RNPDDILLFRDRFDGYIFLDSKGLEYPAVVEFAPFQK
Solution NMR Structure of Nonsense mRNA reducing factor 3A from H. Sapiens, Northeast Structural Genomics Consortium Target HR4714B. Mani, R., Mao, L., Ciccosanti, C. et al. To be published.
Other PDB entries of the same protein (UniProt Q9H1J1 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2L08 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.