Solution NMR Structure of Signal transducing adapter molecule 1 STAM-1 from Homo sapiens, Northeast Structural Genomics Consortium Target HR4479E. Determined by solution NMR. Released 21 Jul 2010.
Explore 2L0A in 3D Show helices and sheets RCSB PDB PDBe
2L0A contains 1 α-helix and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 16-17 | 2 | |
| β-strand | 18-22 | 5 | 1 |
| β-strand | 26 | 1 | 2 |
| β-strand | 33 | 1 | 1 |
| β-strand | 36 | 1 | 2 |
| β-strand | 41-49 | 9 | 1 |
| β-strand | 52-56 | 5 | 1 |
| β-strand | 61-63 | 3 | 1 |
| β-strand | 69-71 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Signal transducing adapter molecule 1 | A | protein | 72 | Homo sapiens | Q92783 (AlphaFold model) |
>2L0A_1 Signal transducing adapter molecule 1 (chains A) MGHHHHHHSHMNHQHEARKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQG IGLFPSNFVTAD
Northeast Structural Genomics Consortium Target HR4479E. Tang, Y., Janjua, H., Ciccosanti, C. et al. To be published.
Other PDB entries of the same protein (UniProt Q92783 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2L0A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.