2L12: Chromobox protein 7 with H3K9me3

Solution NMR structure of the chromobox protein 7 with H3K9me3. Determined by solution NMR. Released 4 Aug 2010.

Method: Solution NMR
Organisms: Homo sapiens, Xenopus laevis
Chains: 2
Atoms: 594
Mol. weight: 8.42 kDa
Released: 4 Aug 2010

Explore 2L12 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L12 contains 2 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	1
β-strand	7-16	10	2
β-strand	19-26	8	2
α-helix	31-33	3
β-strand	35-38	4	2
β-strand	42	1	1
α-helix	45-52	8

Chain B: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	6-8	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chromobox homolog 7	A	protein	56	Homo sapiens	O95931 (AlphaFold model)
Histone H3	B	protein	15	Xenopus laevis	P84233 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L12_1 Chromobox homolog 7 (chains A)
GEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEE

Sequence of entity 2 (B), FASTA

>2L12_2 Histone H3 (chains B)
ARTKQTARKSTGGKA

Primary citation

Recognition and specificity determinants of the human cbx chromodomains. Kaustov, L., Ouyang, H., Amaya, M. et al. J Biol Chem (2011) 286:521-529. DOI 10.1074/jbc.M110.191411 · PubMed

Other PDB entries of the same protein (UniProt O95931 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8SII 1.37 Å, Crystal Structure of CBX7 with compound UNC4976
4MN3 1.54 Å, Chromodomain antagonists that target the polycomb-group methyllysine reader protein…
5EPJ 1.6 Å, Crystal Structure of chromodomain of CBX7 in complex with inhibitor UNC3866
6V2R 1.6 Å, Crystal Structure of chromodomain of CBX7 mutant V13A in complex with inhibitor UNC3866
3GS2 1.7 Å, Ring1B C-terminal domain/Cbx7 Cbox Complex
9V9P 3.4 Å, Cryo-EM structure of the cPRC1-di-nucleosome (CBX7) complex
2K1B Solution NMR structure of the chromo domain of the chromobox protein homolog 7
2L1B Solution NMR structure of the chromobox protein Cbx7 with H3K27me3

Browse structure collections

About this viewer

MolViewer shows 2L12 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.