2L27: ECD1 of CRF-R1

NMR Structure of the ECD1 of CRF-R1 in complex with a peptide agonist. Determined by solution NMR. Released 1 Sept 2010.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 949
Mol. weight: 13.56 kDa
Released: 1 Sept 2010

Explore 2L27 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L27 contains 6 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	126-132	7
β-strand	143	1	1
α-helix	155-157	3
β-strand	159	1	1
β-strand	162	1	2
β-strand	165	1	3
β-strand	172	1	4
β-strand	175	1	4
β-strand	184	1	3
β-strand	187-188	2	2
β-strand	192-193	2	2
α-helix	199-201	3

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	309-324	16
α-helix	325-327	3
α-helix	331-340	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Corticotropin-releasing factor receptor 1	A	protein	84	Homo sapiens	P34998 (AlphaFold model)
peptide agonist	B	protein	38

Sequence of entity 1 (A), FASTA

>2L27_1 Corticotropin-releasing factor receptor 1 (chains A)
LQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGY
RECLANGSWAARVNYSECQEILNE

Sequence of entity 2 (B), FASTA

>2L27_2 peptide agonist (chains B)
PPISLDLTFNLLREVLEIAKAEQEAEEAAKNRLLLEEA

Primary citation

NMR structure of the first extracellular domain of corticotropin-releasing factor receptor 1 (ECD1-CRF-R1) complexed with a high affinity agonist. Grace, C.R., Perrin, M.H., Gulyas, J. et al. J Biol Chem (2010) 285:38580-38589. DOI 10.1074/jbc.M110.121897 · PubMed

Other PDB entries of the same protein (UniProt P34998 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EHU 1.96 Å, Crystal structure of the extracellular domain of human corticotropin releasing factor…
8GTI 2.2 Å, Corticotropin-releasing hormone receptor 1(CRF1R) bound with BMK-C205 by XFEL
8GTM 2.6 Å, Corticotropin-releasing hormone receptor 1(CRF1R) bound with BMK-C203 by XFEL
8GTG 2.75 Å, Corticotropin-releasing hormone receptor 1(CRF1R) bound with BMK-I-152 by XFEL
3EHS 2.76 Å, Crystal structure of the extracellular domain of human corticotropin releasing factor…
6P9X 2.91 Å, CRF1 Receptor Gs GPCR protein complex with CRF1 peptide
4K5Y 2.98 Å, Crystal structure of human corticotropin-releasing factor receptor 1 (CRF1R) in complex…
6PB0 3.0 Å, Cryo-EM structure of Urocortin 1-bound Corticotropin-releasing factor 1 receptor in…
4Z9G 3.18 Å, Crystal structure of human corticotropin-releasing factor receptor 1 (CRF1R) in complex…
3EHT 3.4 Å, Crystal structure of the extracellular domain of human corticotropin releasing factor…

Browse structure collections

About this viewer

MolViewer shows 2L27 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.