2L3L: Tubulin-specific chaperone C

Name: PDB 2L3L: The solution structure of the N-terminal domain of human Tubulin Binding Cofactor C reveals a platform for the interaction with ab-tubulin
Published: 2011-09-21
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: chaperone

The solution structure of the N-terminal domain of human Tubulin Binding Cofactor C reveals a platform for the interaction with ab-tubulin. Determined by solution NMR. Released 21 Sept 2011.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 926
Mol. weight: 13.17 kDa
Released: 21 Sept 2011

Explore 2L3L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L3L contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	32-37	6
α-helix	40-43	4
α-helix	49-55	7
α-helix	56-77	22
α-helix	81-100	20
α-helix	107-131	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tubulin-specific chaperone C	A	protein	111	Homo sapiens	Q15814 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L3L_1 Tubulin-specific chaperone C (chains A)
MPERLQRREQERQLEVERRKQKRQNQEVEKENSHFFVATFARERAAVEELLERAESVERL
EEAASRLQGLQKLINDSVFFLAAYDLRQGQEALARLQAALAERRRGLQPKK

Primary citation

The solution structure of the N-terminal domain of human tubulin binding cofactor C reveals a platform for tubulin interaction. Garcia-Mayoral, M.F., Castano, R., Lopez-Fanarraga, M.L. et al. To be published.

Other PDB entries of the same protein (UniProt Q15814 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9M1M 2.21 Å, Cryo-EM structure of the TBC-DEC-Arl2-alpha-beta-tubulin complex with GDP-AlFx
9M1N 2.24 Å, Cryo-EM structure of the TBC-DC-Arl2-alpha-beta-tubulin complex with GDP-AlFx
2YUH Solution structure of the C-terminal region in human tubulin folding cofactor C

Browse structure collections

About this viewer

MolViewer shows 2L3L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.