2L4N: Chemokine CCL21

Solution Structure of the Chemokine CCL21. Determined by solution NMR. Released 2 Nov 2011.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 555
Mol. weight: 12.52 kDa
Released: 2 Nov 2011

Explore 2L4N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L4N contains 1 α-helix and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 3 β-strands

Element	Residues	Length	Sheet
β-strand	22-27	6	1
β-strand	39-43	5	1
β-strand	51-53	3	1
α-helix	58-68	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-C motif chemokine 21	A	protein	113	Homo sapiens	O00585 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L4N_1 C-C motif chemokine 21 (chains A)
SDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWV
QQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGPKL

Primary citation

Solution structure of CCL21 and identification of a putative CCR7 binding site. Love, M., Sandberg, J.L., Ziarek, J.J. et al. Biochemistry (2012) 51:733-735. DOI 10.1021/bi201601k · PubMed

Other PDB entries of the same protein (UniProt O00585 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5EKI 1.9 Å, Crystal Structure of Truncated CCL21
9XHI 3.2 Å, Structure of the CCL21-CCR7-Gi-scFv16 complex
9KO4 3.3 Å, A Cryo_EM structure of CCR7 complex with CCL21
9L16 3.5 Å, A local Cryo_EM structure of CCR7 complex with CCL21

Browse structure collections

About this viewer

MolViewer shows 2L4N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.