2L5E: Complex between BD1 of Brd3 and GATA-1 C-tail

Complex between BD1 of Brd3 and GATA-1 C-tail. Determined by solution NMR. Released 18 May 2011.

Method: Solution NMR
Organism: Mus musculus
Chains: 2
Atoms: 1,100
Mol. weight: 16.46 kDa
Released: 18 May 2011

Explore 2L5E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L5E contains 8 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	36	1	1
α-helix	37-41	5
α-helix	42-47	6
α-helix	48-51	4
α-helix	57-59	3
α-helix	73-76	4
α-helix	84-91	8
α-helix	101-115	15
α-helix	121-137	17
β-strand	146	1	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bromodomain-containing protein 3	A	protein	128	Mus musculus	Q8K2F0 (AlphaFold model)
Gata-1	B	protein	13	Mus musculus	P17679 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L5E_1 Bromodomain-containing protein 3 (chains A)
GPLGSEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHKIIKN
PMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQ
MPQEEVEL

Sequence of entity 2 (B), FASTA

>2L5E_2 GATA-1 (chains B)
KASGKGKKKRGSN

Primary citation

Structural basis and specificity of acetylated transcription factor GATA1 recognition by BET family bromodomain protein Brd3. Gamsjaeger, R., Webb, S.R., Lamonica, J.M. et al. Mol Cell Biol (2011) 31:2632-2640. DOI 10.1128/MCB.05413-11 · PubMed

Browse structure collections

About this viewer

MolViewer shows 2L5E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.