2L9S: Pf1 SID1-mSin3A PAH2 Complex

Solution structure of Pf1 SID1-mSin3A PAH2 Complex. Determined by solution NMR. Released 11 May 2011.

Method: Solution NMR
Organisms: Homo sapiens, Mus musculus
Chains: 2
Atoms: 1,116
Mol. weight: 15.81 kDa
Released: 11 May 2011

Explore 2L9S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2L9S contains 7 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	209-219	11

Chain B: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	302-317	16
α-helix	322-344	23
α-helix	350-351	2
α-helix	355-365	11
α-helix	370-376	7
α-helix	377-379	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PHD finger protein 12	A	protein	45	Homo sapiens	Q96QT6 (AlphaFold model)
Paired amphipathic helix protein Sin3a	B	protein	94	Mus musculus	Q60520 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2L9S_1 PHD finger protein 12 (chains A)
SNADYVQPQLRRPFELLIAAAMERNPTQFQLPNELTCTTALPGSS

Sequence of entity 2 (B), FASTA

>2L9S_2 Paired amphipathic helix protein Sin3a (chains B)
SNASLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYTP
ALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANS

Primary citation

Solution Structure of the mSin3A PAH2-Pf1 SID1 Complex: A Mad1/Mxd1-Like Interaction Disrupted by MRG15 in the Rpd3S/Sin3S Complex. Kumar, G.S., Xie, T., Zhang, Y. et al. J Mol Biol (2011) 408:987-1000. DOI 10.1016/j.jmb.2011.03.043 · PubMed

Other PDB entries of the same protein (UniProt Q96QT6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8BPB 2.8 Å, Cryo-EM structure of the human SIN3B histone deacetylase core complex at 2.8 Angstrom
8BPC 2.8 Å, Cryo-EM structure of the human SIN3B histone deacetylase core complex with SAHA at 2.8…
8C60 3.4 Å, Cryo-EM structure of the human SIN3B full-length complex at 3.4 Angstrom resolution
8BPA 3.7 Å, Cryo-EM structure of the human SIN3B histone deacetylase complex at 3.7 Angstrom
2LKM Structural Basis for Molecular Interactions Involving MRG Domains: Implications in…

Browse structure collections

About this viewer

MolViewer shows 2L9S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.