2LBF: 60S acidic ribosomal protein P1

Name: PDB 2LBF: Solution structure of the dimerization domain of human ribosomal protein P1/P2 heterodimer
Published: 2011-12-14
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ribosomal protein

Solution structure of the dimerization domain of human ribosomal protein P1/P2 heterodimer. Determined by solution NMR. Released 14 Dec 2011.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,002
Mol. weight: 14.3 kDa
Released: 14 Dec 2011

Explore 2LBF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LBF contains 8 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	4-19	16
α-helix	25-35	11
α-helix	42-50	9
α-helix	56-60	5

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	104-113	10
α-helix	120-128	9
α-helix	138-146	9
α-helix	151-155	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
60S acidic ribosomal protein P1	A	protein	69	Homo sapiens	P05386 (AlphaFold model)
60S acidic ribosomal protein P2	B	protein	70	Homo sapiens	P05387 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LBF_1 60S acidic ribosomal protein P1 (chains A)
MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLI
CNVGAGGPA

Sequence of entity 2 (B), FASTA

>2LBF_2 60S acidic ribosomal protein P2 (chains B)
AMRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGI
GKLASVPAGG

Primary citation

Solution structure of the dimerization domain of the eukaryotic stalk P1/P2 complex reveals the structural organization of eukaryotic stalk complex. Lee, K.-M., Yu, C.W.-H., Chiu, T.Y.-H. et al. Nucleic Acids Res (2011). DOI 10.1093/nar/gkr1143 · PubMed

Other PDB entries of the same protein (UniProt P05386 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4V6X 5.0 Å, Structure of the human 80S ribosome
4BEH Solution structure of human ribosomal protein P1.P2 heterodimer

Browse structure collections

About this viewer

MolViewer shows 2LBF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.