Solution NMR structure of C-terminal globular domain of human Lamin-B2, Northeast Structural Genomics Consortium target HR8546A. Determined by solution NMR. Released 7 Dec 2011.
Explore 2LLL in 3D Show helices and sheets RCSB PDB PDBe
2LLL contains 3 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 454-459 | 6 | 1 |
| β-strand | 465-470 | 6 | 1 |
| β-strand | 476-477 | 2 | 2 |
| β-strand | 482-487 | 6 | 3 |
| β-strand | 492-496 | 5 | 3 |
| α-helix | 497-498 | 2 | |
| β-strand | 502-503 | 2 | 2 |
| α-helix | 504 | 1 | |
| β-strand | 508-513 | 6 | 1 |
| α-helix | 514-516 | 3 | |
| β-strand | 521 | 1 | 1 |
| β-strand | 525-528 | 4 | 1 |
| β-strand | 539-545 | 7 | 3 |
| β-strand | 551-558 | 8 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Lamin-B2 | A | protein | 139 | Homo sapiens | Q03252 (AlphaFold model) |
>2LLL_1 Lamin-B2 (chains A) MHHHHHHSSGRENLYFQGSASGSVSIEEIDLEGKFVQLKNNSDKDQSLGNWRIKRQVLEG EEIAYKFTPKYILRAGQMVTVWAAGAGVAHSPPSTLVWKGQSSWGTGESFRTVLVNADGE EVAMRTVKKSSVMRENENG
NMR solution structure of c-terminal globular domain of human Lamin-B2. Lemak, A., Yee, A., Houliston, S. et al. To be published.
Other PDB entries of the same protein (UniProt Q03252 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2LLL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.