Solution structure of the yeast Sti1 DP2 domain. Determined by solution NMR. Released 25 Jan 2012.
Explore 2LLW in 3D Show helices and sheets RCSB PDB PDBe
2LLW contains 5 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 527-536 | 10 | |
| α-helix | 538-544 | 7 | |
| α-helix | 548-558 | 11 | |
| α-helix | 560-568 | 9 | |
| α-helix | 570-581 | 12 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Heat shock protein STI1 | A | protein | 71 | Saccharomyces cerevisiae | P15705 (AlphaFold model) |
>2LLW_1 Heat shock protein STI1 (chains A) QPGTSNETPEETYQRAMKDPEVAAIMQDPVMQSILQQAQQNPAALQEHMKNPEVFKKIQT LIAAGIIRTGR
The architecture of functional modules in the Hsp90 co-chaperone Sti1/Hop. Schmid, A.B., Lagleder, S., Grawert, M.A. et al. EMBO J (2012) 31:1506-1517. DOI 10.1038/emboj.2011.472 · PubMed
Other PDB entries of the same protein (UniProt P15705 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2LLW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.