2LO3: Sgf73(59-102) zinc finger domain

Solution structure of Sgf73(59-102) zinc finger domain. Determined by solution NMR. Released 25 Jan 2012.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 335
Mol. weight: 4.86 kDa
Ligands: ZN
Released: 25 Jan 2012

Explore 2LO3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LO3 contains 3 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	8-10	3
α-helix	14-16	3
β-strand	17-19	3	1
β-strand	26-28	3	1
α-helix	32-38	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SAGA-associated factor 73	A	protein	44	Saccharomyces cerevisiae	P53165 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LO3_1 SAGA-associated factor 73 (chains A)
NPNAQLIEDPLDKPIQYRVCEKCGKPLALTAIVDHLENHCAGAS

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	1

Primary citation

Insights into the role of SGF11 and SGF73 for the interaction between SAGA and nucleosomes. Koehler, C., Gao, X., Bonnet, J. et al. To be published.

Other PDB entries of the same protein (UniProt P53165 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3MHS 1.89 Å, Structure of the SAGA Ubp8/Sgf11/Sus1/Sgf73 DUB module bound to ubiquitin aldehyde
4FK5 2.03 Å, Structure of the SAGA Ubp8(S144N)/Sgf11/Sus1/Sgf73 DUB module
6AQR 2.1 Å, SAGA DUB module Ubp8(C146A)/Sgf11/Sus1/Sgf73 bound to monoubiquitin
4WA6 2.36 Å, Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
3MHH 2.45 Å, Structure of the SAGA Ubp8/Sgf11/Sus1/Sgf73 DUB module
4FIP 2.69 Å, Structure of the SAGA Ubp8(S144N)/Sgf11(1-72, Delta-ZnF)/Sus1/Sgf73 DUB module
3M99 2.7 Å, Structure of the Ubp8-Sgf11-Sgf73-Sus1 SAGA DUB module
4W4U 2.8 Å, Structure of yeast SAGA DUBm with Sgf73 Y57A mutant at 2.8 angstroms resolution
4FJC 2.83 Å, Structure of the SAGA Ubp8/Sgf11(1-72, Delta-ZnF)/Sus1/Sgf73 DUB module
6T9K 3.3 Å, SAGA Core module
6T9L 3.6 Å, SAGA DUB module bound to a ubiqitinated nucleosome
4ZUX 3.82 Å, SAGA DUB module Ubp8/Sgf11/Sus1/Sgf73 bound to ubiqitinated nucleosome

Browse structure collections

About this viewer

MolViewer shows 2LO3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.