2LP0: Homeodomain-protein complex

The solution structure of homeodomain-protein complex. Determined by solution NMR. Released 6 Jun 2012.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 704
Mol. weight: 10.07 kDa
Released: 6 Jun 2012

Explore 2LP0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LP0 contains 3 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	26-38	13
α-helix	44-53	10
α-helix	58-73	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Homeobox protein Hox-C9	A	protein	60	Homo sapiens	P31274 (AlphaFold model)
Geminin	B	protein	20	Homo sapiens	O75496 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LP0_1 Homeobox protein Hox-C9 (chains A)
TRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTERQVKIWFQNRRMKMKKMN

Sequence of entity 2 (B), FASTA

>2LP0_2 Geminin (chains B)
NQEFDSEEETVEDSLVEDSE

Primary citation

Structural basis for homeodomain recognition by the cell-cycle regulator Geminin. Zhou, B., Liu, C., Xu, Z. et al. Proc Natl Acad Sci U S A (2012). DOI 10.1073/pnas.1200874109 · PubMed

Other PDB entries of the same protein (UniProt P31274 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2MSY Solution structure of Hox homeodomain

Browse structure collections

About this viewer

MolViewer shows 2LP0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.