2LP7: Envelope glycoprotein

Structure of gp41-M-MAT, a membrane associated MPER trimer from HIV-1 gp41. Determined by solution NMR. Released 6 Feb 2013.

Method: Solution NMR
Organism: Human immunodeficiency virus 1
Chains: 3
Atoms: 1,500
Mol. weight: 21.03 kDa
Released: 6 Feb 2013

Explore 2LP7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LP7 contains 9 α-helices and 8 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	12-16	5	1
β-strand	19-22	4	1
α-helix	24-27	4
α-helix	33-48	16
α-helix	50-58	9

Chain B: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	12-13	2	2
β-strand	14-16	3	1
β-strand	19-21	3	1
α-helix	24-27	4
α-helix	33-48	16
α-helix	50-58	9

Chain C: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	12-13	2	1
β-strand	14-16	3	2
β-strand	19-21	3	2
α-helix	23-27	5
α-helix	33-48	16
α-helix	51-58	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Envelope glycoprotein	A, B, C	protein	59	Human immunodeficiency virus 1	M1E1E4 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>2LP7_1 Envelope glycoprotein (chains A, B, C)
GYIPEAPRDGQAYVRKDGEWVLLSTFLGSSGNEQELLELDKWASLWNWFNITNWLWYIK

Primary citation

Structure of an HIV-1-neutralizing antibody target, the lipid-bound gp41 envelope membrane proximal region trimer. Reardon, P.N., Sage, H., Dennison, S.M. et al. Proc Natl Acad Sci U S A (2014) 111:1391-1396. DOI 10.1073/pnas.1309842111 · PubMed

Other PDB entries of the same protein (UniProt M1E1E4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9BJM 2.07 Å, Crystal Structure of Inhibitor 5c in Complex with Prefusion RSV F Glycoprotein
6VKE 2.1 Å, Crystal Structure of Inhibitor JNJ-40012665 in Complex with Prefusion RSV F Glycoprotein
6A0Z 2.33 Å, Crystal structure of broadly neutralizing antibody 13D4 bound to H5N1 influenza…
5KWW 2.5 Å, Crystal Structure of Inhibitor JNJ-53718678 In Complex with Prefusion RSV F Glycoprotein
6VKD 2.5 Å, Crystal Structure of Inhibitor JNJ-36689282 in Complex with Prefusion RSV F Glycoprotein
6VKC 2.6 Å, Crystal Structure of Inhibitor JNJ-36811054 in Complex with Prefusion RSV F Glycoprotein
7ZRV 2.8 Å, cryo-EM structure of omicron spike in complex with de novo designed binder, full map
7AD1 2.92 Å, Cryo-EM structure of a prefusion stabilized SARS-CoV-2 Spike (D614N, R682S, R685G,…
7QTI 3.04 Å, SARS-CoV-2 S Omicron Spike B.1.1.529 - 3-P2G3 and 1-P5C3 Fabs (Global)
5U68 3.08 Å, Structural basis for antibody cross-neutralization of respiratory syncytial virus and…
6W16 3.1 Å, Crystal structure of a human metapneumovirus monomeric fusion protein complexed with 458…
7FJN 3.25 Å, Cryo-EM structure of South African (B.1.351) SARS-CoV-2 spike glycoprotein in complex…

Browse structure collections

About this viewer

MolViewer shows 2LP7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.