2LQ7: NEDD8-activating enzyme E1 catalytic subunit

E2 binding surface on Uba3 beta-grasp domain undergoes a conformational transition. Determined by solution NMR. Released 25 Jul 2012.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 749
Mol. weight: 10.66 kDa
Released: 25 Jul 2012

Explore 2LQ7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2LQ7 contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	350	1
β-strand	351-355	5	1
β-strand	360	1	2
α-helix	361-368	8
β-strand	380-385	6	1
β-strand	388-391	4	1
α-helix	406-409	4
β-strand	411	1	2
β-strand	421-426	6	1
β-strand	433-440	8	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
NEDD8-activating enzyme E1 catalytic subunit	A	protein	97	Homo sapiens	Q8TBC4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2LQ7_1 NEDD8-activating enzyme E1 catalytic subunit (chains A)
GSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSPAITATLEGKNRTLYLQSVTSIEERTR
PNLSKTLKELGLVDGQELAVADVTTPQTVLFKLHFTS

Primary citation

E2-binding surface on Uba3 beta-grasp domain undergoes a conformational transition. Elgin, E.S., Sokmen, N., Peterson, F.C. et al. Proteins (2012) 80:2482-2487. DOI 10.1002/prot.24148 · PubMed

Other PDB entries of the same protein (UniProt Q8TBC4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5JJM 2.15 Å, Crystal Structure of Homodimeric Androgen Receptor Ligand-Binding Domain bound to DHT…
1Y8X 2.4 Å, Structural basis for recruitment of Ubc12 by an E2-binding domain in NEDD8's E1
3FN1 2.5 Å, E2-RING expansion of the NEDD8 cascade confers specificity to cullin modification.
1TT5 2.6 Å, Structure of APPBP1-UBA3-Ubc12N26: a unique E1-E2 interaction required for optimal…
1YOV 2.6 Å, Insights into the Ubiquitin Transfer Cascade from the refined structure of the…
3DBH 2.85 Å, Structural Dissection of a Gating Mechanism Preventing Misactivation of Ubiquitin by…
3DBL 2.9 Å, Structural Dissection of a Gating Mechanism Preventing Misactivation of Ubiquitin by…
1R4M 3.0 Å, APPBP1-UBA3-NEDD8, an E1-ubiquitin-like protein complex
3GZN 3.0 Å, Structure of NEDD8-activating enzyme in complex with NEDD8 and MLN4924
3DBR 3.05 Å, Structural Dissection of a Gating Mechanism Preventing Misactivation of Ubiquitin by…
1R4N 3.6 Å, APPBP1-UBA3-NEDD8, an E1-ubiquitin-like protein complex with ATP

Browse structure collections

About this viewer

MolViewer shows 2LQ7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.