Solution NMR structure of the PHD domain of human MLL5, Northeast structural genomics consortium target HR6512A. Determined by solution NMR. Released 5 Sept 2012.
Explore 2LV9 in 3D Show helices and sheets RCSB PDB PDBe
2LV9 contains 1 α-helix and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 118 | 1 | 1 |
| β-strand | 132-134 | 3 | 2 |
| β-strand | 135 | 1 | 3 |
| β-strand | 140 | 1 | 1 |
| β-strand | 141-143 | 3 | 2 |
| β-strand | 158 | 1 | 3 |
| α-helix | 170-183 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Histone-lysine N-methyltransferase MLL5 | A | protein | 98 | Homo sapiens | Q8IZD2 (AlphaFold model) |
>2LV9_1 Histone-lysine N-methyltransferase MLL5 (chains A) MHHHHHHSSGRENLYFQGSEDGSYGTDVTRCICGFTHDDGYMICCDKCSVWQHIDCMGID RQHIPDTYLCERCQPRNLDKERAVLLQRRKRENMSDGD
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
NMR solution structure of the human MLL5 PHD domain (CASP Target). Lemak, A., Yee, A., Houliston, S. et al. To be published.
Other PDB entries of the same protein (UniProt Q8IZD2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2LV9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.