2M14: PDB entry 2M14

NMR structure of the complex between the PH domain of the Tfb1 subunit from TFIIH and Rad4. Determined by solution NMR. Released 23 Jan 2013.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 1,023
Mol. weight: 17.85 kDa
Released: 23 Jan 2013

Explore 2M14 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2M14 contains 3 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	1
β-strand	8-9	2	2
β-strand	12-13	2	2
β-strand	14-19	6	1
β-strand	26-31	6	1
β-strand	37-41	5	1
β-strand	47-50	4	3
β-strand	60-63	4	3
α-helix	64-65	2
β-strand	72	1	4
β-strand	80	1	4
α-helix	82-84	3
β-strand	86-88	3	3
β-strand	90	1	2
α-helix	94-112	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RNA polymerase II transcription factor B subunit 1	A	protein	119	Saccharomyces cerevisiae	P32776 (AlphaFold model)
DNA repair protein RAD4	B	protein	42	Saccharomyces cerevisiae	P14736 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2M14_1 RNA polymerase II transcription factor B subunit 1 (chains A)
PSHSGAAIFEKVSGIIAINEDVSPAELTWRSTDGDKVHTVVLSTIDKLQATPASSEKMML
RLIGKVDESKKRKDNEGNEVVPKPQRHMFSFNNRTVMDNIKMTLQQIISRYKDADGNSS

Sequence of entity 2 (B), FASTA

>2M14_2 DNA repair protein RAD4 (chains B)
GSTDDSVEEIQSSEEDYDSEEFEDVTDGNEVAGVEDISVEIK

Primary citation

Structural and functional evidence that Rad4 competes with Rad2 for binding to the Tfb1 subunit of TFIIH in NER. Lafrance-Vanasse, J., Arseneault, G., Cappadocia, L. et al. Nucleic Acids Res (2013) 41:2736-2745. DOI 10.1093/nar/gks1321 · PubMed

Other PDB entries of the same protein (UniProt P32776 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7O4J 2.9 Å, Yeast RNA polymerase II transcription pre-initiation complex (consensus)
7ML0 3.0 Å, RNA polymerase II pre-initiation complex (PIC1)
8CEN 3.0 Å, Yeast RNA polymerase II transcription pre-initiation complex with core Mediator
7ML4 3.1 Å, RNA polymerase II initially transcribing complex (ITC)
7ZS9 3.1 Å, Yeast RNA polymerase II transcription pre-initiation complex with the +1 nucleosome…
7O4I 3.2 Å, Yeast RNA polymerase II transcription pre-initiation complex with initial transcription…
7O75 3.2 Å, Yeast RNA polymerase II transcription pre-initiation complex with open promoter DNA
7ML2 3.4 Å, RNA polymerase II pre-initiation complex (PIC3)
7O4L 3.4 Å, Yeast TFIIH in the expanded state within the pre-initiation complex
7O72 3.4 Å, Yeast RNA polymerase II transcription pre-initiation complex with closed promoter DNA
7O73 3.4 Å, Yeast RNA polymerase II transcription pre-initiation complex with closed distorted…
7O4K 3.6 Å, Yeast TFIIH in the contracted state within the pre-initiation complex

Browse structure collections

About this viewer

MolViewer shows 2M14 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.