2M3H: Dido PHD domain

Structure of Dido PHD domain. Determined by solution NMR. Released 7 Aug 2013.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 487
Mol. weight: 7.18 kDa
Ligands: ZN
Released: 7 Aug 2013

Explore 2M3H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2M3H contains 2 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	21-24	4	1
β-strand	29-32	4	1
α-helix	33-36	4
α-helix	40-49	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Death-inducer obliterator 1	A	protein	61	Homo sapiens	Q9BTC0 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2M3H_1 Death-inducer obliterator 1 (chains A)
GSMDPNALYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTI
L

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

NMR structure note: PHD domain from death inducer obliterator protein and its interaction with H3K4me3. Santiveri, C.M., Garcia-Mayoral, M.F., Perez-Canadillas, J.M. et al. J Biomol NMR (2013) 56:183-190. DOI 10.1007/s10858-013-9726-x · PubMed

Other PDB entries of the same protein (UniProt Q9BTC0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4L7X 1.35 Å, Crystal structure of the DIDO PHD finger in complex with H3K4me3

Browse structure collections

About this viewer

MolViewer shows 2M3H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.