Solution structure of the C-terminal zinc-binding domain of HPV51 oncoprotein E6. Determined by solution NMR. Released 15 May 2013.
Explore 2M3L in 3D Show helices and sheets RCSB PDB PDBe
2M3L contains 3 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 81-83 | 3 | 1 |
| α-helix | 85-91 | 7 | |
| β-strand | 102-103 | 2 | 1 |
| β-strand | 109 | 1 | 1 |
| α-helix | 112-120 | 9 | |
| β-strand | 125-128 | 4 | 1 |
| β-strand | 131-134 | 4 | 1 |
| α-helix | 137-143 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein E6 | A | protein | 76 | Human papillomavirus type 51 | P26554 (AlphaFold model) |
>2M3L_1 Protein E6 (chains A) GSHMSRSVYGTTLEAITKKSLYDLSIRCHRCQRPLGPEEKQKLVDEKKRFHEIAGRWTGQ CANCWQRTRQRNETQV
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Structural insights into a wildtype domain of the oncoprotein E6 and its interaction with a PDZ domain. Mischo, A., Ohlenschlager, O., Hortschansky, P. et al. PLoS One (2013) 8:e62584-e62584. DOI 10.1371/journal.pone.0062584 · PubMed
Other PDB entries of the same protein (UniProt P26554 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2M3L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.