2M5I: Human apoptotic protein tBid in LPPG micelle

NMR structures of human apoptotic protein tBid in LPPG micelle. Determined by solution NMR. Released 13 Nov 2013.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,067
Mol. weight: 15.24 kDa
Released: 13 Nov 2013

Explore 2M5I in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2M5I contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	79-95	17
α-helix	96-98	3
α-helix	106-116	11
α-helix	125-136	12
α-helix	143-160	18
α-helix	167-189	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
BH3-interacting domain death agonist	A	protein	135	Homo sapiens	P55957 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2M5I_1 BH3-interacting domain death agonist (chains A)
GNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSE
EDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQ
NLRTYVRSLARNGMD

Primary citation

Structural Insights of tBid, the Caspase-8-activated Bid, and Its BH3 Domain. Wang, Y., Tjandra, N. J Biol Chem (2013) 288:35840-35851. DOI 10.1074/jbc.M113.503680 · PubMed

Other PDB entries of the same protein (UniProt P55957 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7QTW 1.41 Å, Kaposi sarcoma associated herpes virus(KSHV) encoded apoptosis inhibitor, KsBcl-2 in…
5C3F 1.43 Å, Crystal structure of Mcl-1 bound to BID-MM
7M5A 1.5 Å, Crystal Structure of human BAK in complex with W3W5_BID
5AJJ 1.75 Å, Crystal structure of variola virus virulence factor F1L in complex with human Bid BH3…
4ZEQ 1.8 Å, Crystal Structure of human BFL-1 in complex with tBid BH3 peptide, Northeast Structural…
7M5B 1.85 Å, Crystal Structure of human BAK in complex with M3W5_BID
4QVE 2.05 Å, Crystal structure of Bcl-xL in complex with BID BH3 domain
4ZII 2.19 Å, Crystal Structure of core/latch dimer of BaxI66A in complex with BidBH3
4ZIG 2.2 Å, Crystal Structure of core/latch dimer of Bax in complex with BidBH3mini
4BD2 2.21 Å, Bax domain swapped dimer in complex with BidBH3
8SM5 2.61 Å, Crystal Structure of BHRF1 from Epstein Barr Virus in complex with BID BH3 peptide
7P33 2.79 Å, Epstein-Barr virus encoded Bcl-2 homolog BHRF-1 in complex with Bid BH3 peptide

Browse structure collections

About this viewer

MolViewer shows 2M5I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.