Independently verified structure of gp41-M-MAT, a membrane associated MPER trimer from HIV-1 gp41. Determined by solution NMR. Released 15 May 2013.
Explore 2M7W in 3D Show helices and sheets RCSB PDB PDBe
2M7W contains 12 α-helices and 9 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 12-13 | 2 | 1 |
| β-strand | 14-16 | 3 | 2 |
| β-strand | 19-21 | 3 | 2 |
| α-helix | 24-27 | 4 | |
| α-helix | 30-32 | 3 | |
| α-helix | 33-47 | 15 | |
| α-helix | 50-58 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Envelope glycoprotein | A, B, C | protein | 59 | Human immunodeficiency virus 1 | M1E1E4 (AlphaFold model) |
>2M7W_1 Envelope glycoprotein (chains A, B, C) GYIPEAPRDGQAYVRKDGEWVLLSTFLGSSGNEQELLELDKWASLWNWFNITNWLWYIK
Structure of an HIV-1-neutralizing antibody target, the lipid-bound gp41 envelope membrane proximal region trimer. Reardon, P.N., Sage, H., Dennison, S.M. et al. Proc Natl Acad Sci U S A (2014) 111:1391-1396. DOI 10.1073/pnas.1309842111 · PubMed
Other PDB entries of the same protein (UniProt M1E1E4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2M7W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.