Solution structure of the carbohydrate binding module of the muscle glycogen-targeting subunit of Protein Phosphatase-1. Determined by solution NMR. Released 14 May 2014.
Explore 2M83 in 3D Show helices and sheets RCSB PDB PDBe
2M83 contains 3 α-helices and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 108-110 | 3 | 1 |
| α-helix | 118-125 | 8 | |
| β-strand | 130-137 | 8 | 2 |
| β-strand | 144-151 | 8 | 2 |
| β-strand | 157-164 | 8 | 3 |
| β-strand | 174-175 | 2 | 3 |
| α-helix | 176 | 1 | |
| β-strand | 177-178 | 2 | 2 |
| α-helix | 179 | 1 | |
| β-strand | 187-193 | 7 | 2 |
| β-strand | 207 | 1 | 1 |
| β-strand | 208-215 | 8 | 3 |
| β-strand | 218-222 | 5 | 3 |
| β-strand | 231-235 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein phosphatase 1 regulatory subunit 3A | A | protein | 139 | Oryctolagus cuniculus | Q00756 (AlphaFold model) |
>2M83_1 Protein phosphatase 1 regulatory subunit 3A (chains A) GHMQTEEYVLSPLFDLPASKEDLMQQLQVQKAMLESTEYVPGSTSMKGIIRVLNISFEKL VYVRMSLDDWQTHYDILAEYVPNSCDGETDQFSFKISLVPPYQKDGSKVEFCIRYETSVG TFWSNNNGTNYTLVCQKKE
Molecular basis for Protein Phosphatase-1 regulation by the muscle glycogen-targeting subunit GM. Koveal, D., Choy, M., Page, R. et al. To be published.
Other PDB entries of the same protein (UniProt Q00756 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2M83 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.