2MBE: Ubiquitin D

Backbone 1H and 15N Chemical Shift Assignments for the first domain of FAT10. Determined by solution NMR. Released 27 Aug 2014.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 608
Mol. weight: 8.68 kDa
Released: 27 Aug 2014

Explore 2MBE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MBE contains 1 α-helix and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 5 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
β-strand	13-14	2	1
α-helix	23-28	6
β-strand	42-44	3	1
β-strand	49-50	2	1
β-strand	67-72	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin D	A	protein	75	Homo sapiens	O15205 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MBE_1 Ubiquitin D (chains A)
LCVHVRSEEWDLMTFDANPYDSVLKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYG
IDKEKTIHLTLKVVK

Primary citation

Disruption of FAT10-MAD2 binding inhibits tumor progression. Theng, S.S., Wang, W., Mah, W.C. et al. Proc Natl Acad Sci U S A (2014) 111:E5282-E5291. DOI 10.1073/pnas.1403383111 · PubMed

Other PDB entries of the same protein (UniProt O15205 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6GF1 1.93 Å, The structure of the ubiquitin-like modifier FAT10 reveals a novel targeting mechanism…
28MJ 2.77 Å, Cryo-EM structure of UBA6 in complex with FAT10 in the pre-adenylation state.
28MQ 3.04 Å, Cryo-EM structure of UBA6-FAT10Dha-UBE2Z trapped ternary complex
9E8O 3.1 Å, Nub1/Fat10-processing human 26S proteasome bound to Txnl1 with Rpt2 at top of spiral…
7PYV 3.27 Å, Crystal structure of human UBA6 in complex with the ubiquitin-like modifier FAT10
28MK 3.53 Å, Cryo-EM structure of UBA6 in complex with FAT10 in the post-thiolation state.
6GF2 The structure of the ubiquitin-like modifier FAT10 reveals a novel targeting mechanism…

Browse structure collections

About this viewer

MolViewer shows 2MBE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.