LMO4-LIM2 in complex with DEAF1 (404-418). Determined by solution NMR. Released 20 Aug 2014.
Explore 2MBV in 3D Show helices and sheets RCSB PDB PDBe
2MBV contains 4 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 80 | 1 | 1 |
| β-strand | 83 | 1 | 1 |
| β-strand | 100-102 | 3 | 2 |
| β-strand | 107-109 | 3 | 2 |
| β-strand | 114 | 1 | 3 |
| α-helix | 120 | 1 | |
| β-strand | 121 | 1 | 3 |
| α-helix | 122 | 1 | |
| β-strand | 124 | 1 | 4 |
| β-strand | 126 | 1 | 4 |
| β-strand | 127 | 1 | 5 |
| β-strand | 128-131 | 4 | 6 |
| β-strand | 134-137 | 4 | 6 |
| β-strand | 404 | 1 | 5 |
| α-helix | 405-407 | 3 | |
| β-strand | 408-409 | 2 | 2 |
| α-helix | 413-415 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fusion protein of LIM domain transcription factor LMO4 (77-147) and DEAF1 (404-418) | A | protein | 96 | Mus musculus | P61969 (AlphaFold model), Q9Z1T5 (AlphaFold model) |
>2MBV_1 Fusion protein of LIM domain transcription factor LMO4 (77-147) and DEAF1 (404-418) (chains A) GSYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGS LFCEHDRPTALINGGSGGSGSIAPFPEAALPTSHPK
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Structural characterisation of LIM-only protein 4 (LMO4) in complex with Deformed Epidermal Autoregulatory Factor-1 (DEAF1). Joseph, S., Kwan, A.H., Foo, P. et al. To be published.
Other PDB entries of the same protein (UniProt P61969 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2MBV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.