2MF7: PDB entry 2MF7

Solution structure of the ims domain of the mitochondrial import protein TIM21 from S. cerevisiae. Determined by solution NMR. Released 29 Oct 2014.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 1
Atoms: 1,036
Mol. weight: 14.76 kDa
Released: 29 Oct 2014

Explore 2MF7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MF7 contains 3 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	6-20	15
α-helix	22-27	6
β-strand	33-34	2	1
β-strand	36	1	1
α-helix	38-40	3
β-strand	41-43	3	2
β-strand	59-60	2	2
β-strand	63-64	2	2
β-strand	70-79	10	2
β-strand	84-93	10	2
β-strand	101-109	9	2
β-strand	112-118	7	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitochondrial import inner membrane translocase subunit TIM21	A	protein	127	Saccharomyces cerevisiae	P53220 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MF7_1 Mitochondrial import inner membrane translocase subunit TIM21 (chains A)
GAMGSGDTQLFNRAVSMVEKNKDIRSLLQCDDGITGKERLKAYGELITNDKWTRNRPIVS
TKKLDKEGRTHHYMRFHVESKKKIALVHLEAKESKQNYQPDFINMYVDVPGEKRYYLIKP
KLHPVSN

Primary citation

Molecular Basis of the Dynamic Structure of the TIM23 Complex in the Mitochondrial Intermembrane Space. Bajaj, R., Jaremko, L., Jaremko, M. et al. Structure (2014) 22:1501-1511. DOI 10.1016/j.str.2014.07.015 · PubMed

Other PDB entries of the same protein (UniProt P53220 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6K7E 1.53 Å, Crystal structure of MBPapo-Tim21 fusion protein with a 17-residue helical linker
2CIU 1.6 Å, Structure of the IMS domain of the mitochondrial import protein Tim21 from S. cerevisiae
6K7F 1.8 Å, Crystal structure of MBPholo-Tim21 fusion protein with a 17-residue helical linker
6K7D 2.0 Å, Crystal structure of MBPapo-Tim21 fusion protein with a 16-residue helical linker
6K8Q Solution structure of the intermembrane space domain of the mitochondrial import protein…

Browse structure collections

About this viewer

MolViewer shows 2MF7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.