2MGS: CXCL5

Solution structure of CXCL5. Determined by solution NMR. Released 2 Apr 2014.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,090
Mol. weight: 16.74 kDa
Released: 2 Apr 2014

Explore 2MGS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MGS contains 4 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 2 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	24-26	3
β-strand	27-33	7	1
β-strand	43-48	6	1
β-strand	53-56	4	1
α-helix	61-72	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-X-C motif chemokine 5	A, B	protein	78	Homo sapiens	P42830 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>2MGS_1 C-X-C motif chemokine 5 (chains A, B)
AGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEA
PFLKKVIQKILDGGNKEN

Primary citation

Solution Structure of CXCL5 - A Novel Chemokine and Adipokine Implicated in Inflammation and Obesity. Sepuru, K.M., Poluri, K.M., Rajarathnam, K. PLoS One (2014) 9:e93228-e93228. DOI 10.1371/journal.pone.0093228 · PubMed

Other PDB entries of the same protein (UniProt P42830 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8XWS 3.06 Å, Structure of CXCR2 bound to CXCL5 (Ligand-receptor focused map)
8XX7 3.32 Å, Structure of CXCR2 bound to CXCL5 (CXCR2-CXCL5-Go Full map)

Browse structure collections

About this viewer

MolViewer shows 2MGS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.