Structure of insect-specific sodium channel toxin mu-Dc1a. Determined by solution NMR. Released 23 Jul 2014.
Explore 2MI5 in 3D Show helices and sheets RCSB PDB PDBe
2MI5 contains 0 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 7-8 | 2 | 1 |
| β-strand | 24 | 1 | 2 |
| β-strand | 28-31 | 4 | 1 |
| β-strand | 34-36 | 3 | 1 |
| β-strand | 38-43 | 6 | 2 |
| β-strand | 51-56 | 6 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mu-diguetoxin-Dc1a | A | protein | 57 | Diguetia canities | P49126 (AlphaFold model) |
>2MI5_1 Mu-diguetoxin-Dc1a (chains A) SAKDGDVEGPAGCKKYDVECDSGECCQKQYLWYKWRPLDCRCLKSGFFSSKCVCRDV
A distinct sodium channel voltage-sensor locus determines insect selectivity of the spider toxin Dc1a. Bende, N.S., Dziemborowicz, S., Mobli, M. et al. Nat Commun (2014) 5:4350-4350. DOI 10.1038/ncomms5350 · PubMed
Other PDB entries of the same protein (UniProt P49126 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2MI5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.