Solution structure of tandem RRM domains of cytoplasmic polyadenylation element binding protein 4 (CPEB4) in free state. Determined by solution NMR. Released 23 Jul 2014.
Explore 2MKJ in 3D Show helices and sheets RCSB PDB PDBe
2MKJ contains 5 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 64-69 | 6 | 1 |
| α-helix | 78-84 | 7 | |
| β-strand | 91-94 | 4 | 1 |
| β-strand | 111-115 | 5 | 1 |
| α-helix | 120-126 | 7 | |
| β-strand | 129-130 | 2 | 1 |
| β-strand | 135-137 | 3 | 1 |
| α-helix | 148 | 1 | |
| β-strand | 149-154 | 6 | 1 |
| β-strand | 160-162 | 3 | 2 |
| β-strand | 174-178 | 5 | 2 |
| α-helix | 187-196 | 10 | |
| β-strand | 202-208 | 7 | 2 |
| β-strand | 213-221 | 9 | 2 |
| α-helix | 226-232 | 7 | |
| β-strand | 238-241 | 4 | 3 |
| β-strand | 244-246 | 3 | 3 |
| β-strand | 249-252 | 4 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Cytoplasmic polyadenylation element-binding protein 4 | A | protein | 203 | Homo sapiens | Q17RY0 (AlphaFold model) |
>2MKJ_1 Cytoplasmic polyadenylation element-binding protein 4 (chains A) SHQNGERVERYSRKVFVGGLPPDIDEDEITASFRRFGPLIVDWPHKAESKSYFPPKGYAF LLFQDESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPR KTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAI SARFVQLQHGEIDKRVEVKPYVL
A fly trap mechanism provides sequence-specific RNA recognition by CPEB proteins. Afroz, T., Skrisovska, L., Belloc, E. et al. Genes Dev (2014) 28:1498-1514. DOI 10.1101/gad.241133.114 · PubMed
Other PDB entries of the same protein (UniProt Q17RY0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 2MKJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.