2MP1: Human chemokine CCL19

Solution structure of the human chemokine CCL19. Determined by solution NMR. Released 10 Jun 2015.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 616
Mol. weight: 8.81 kDa
Released: 10 Jun 2015

Explore 2MP1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2MP1 contains 1 α-helix and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 3 β-strands

Element	Residues	Length	Sheet
β-strand	22-28	7	1
β-strand	38-43	6	1
β-strand	48-51	4	1
α-helix	56-69	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
C-C motif chemokine 19	A	protein	77	Homo sapiens	Q99731 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2MP1_1 C-C motif chemokine 19 (chains A)
GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVER
IIQRLQRTSAKMKRRSS

Primary citation

Solution Structure of CCL19 and Identification of Overlapping CCR7 and PSGL-1 Binding Sites. Veldkamp, C.T., Kiermaier, E., Gabel-Eissens, S.J. et al. Biochemistry (2015) 54:4163-4166. DOI 10.1021/acs.biochem.5b00560 · PubMed

Other PDB entries of the same protein (UniProt Q99731 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7STA 2.5 Å, X-ray Crystal Structure of Truncated Human Chemokine CCL19 (7-70)
9KO2 2.98 Å, A Cryo_EM structure of CCR7 complex with CCL19
9XHH 3.0 Å, Structure of the CCL19-CCR7-Gi-scFv16 complex
9KO6 3.3 Å, A local Cryo_EM structure of CCR7 complex with CCL19

Browse structure collections

About this viewer

MolViewer shows 2MP1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.